LC-MS raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-11-11. Anything still debated is marked as such rather than presented as settled.
Laboratory measurement of NAD+ often begins with rapid quenching of cell or tissue samples to prevent enzymatic conversion. Acidic or alkaline extraction can precipitate proteins, but the chosen method affects recovery of oxidized and reduced forms. Enzymatic cycling assays provide high sensitivity by amplifying a NAD+-dependent reaction. High-performance liquid chromatography and mass spectrometry offer separation and structural confirmation. Each method has trade-offs in throughput, specificity, and the ability to distinguish NAD+ from close analogues.
Purified NAD+ is typically supplied as a white to off-white powder and stored desiccated at low temperature. Airtight containers limit moisture uptake, while protection from light reduces degradation of the nicotinamide ring. Aqueous stock solutions are less stable than solid material and are often aliquoted before freezing. Repeated freeze-thaw cycles can lower integrity, so working portions are kept separate. Purity is commonly checked by ultraviolet absorbance near 260 nm, high-performance liquid chromatography, or mass spectrometry.
Stability studies show that NAD+ can hydrolyze under prolonged heat, extreme pH, or microbial contamination. Phosphate buffers near neutral pH are often used for short-term handling, though exact stability depends on concentration, temperature, and matrix. In biological samples, endogenous enzymes can rapidly degrade NAD+, making cold chain and fast processing important. Analytical reports should state extraction conditions, internal standards, and validation parameters. Without those details, comparisons across studies remain difficult and potentially misleading.
Quantification of NAD+ in biological samples usually relies on separation techniques coupled to sensitive detection. High-performance liquid chromatography with ultraviolet detection can measure the oxidized form by its absorbance near 260 nm, while mass spectrometry provides greater specificity and can distinguish NAD+ from close analogs. Enzymatic cycling assays use coupled dehydrogenase reactions to amplify signal and estimate NAD+ concentrations in cell or tissue extracts. Because NAD+ and NADH interconvert rapidly, sample preparation must quench metabolism quickly and preserve the redox state before analysis.
The stability of NAD+ depends on pH, temperature, light exposure, and the presence of degradative enzymes. Aqueous solutions are generally more stable under mildly acidic to neutral conditions and degrade faster under alkaline conditions or prolonged heat. The solid is hygroscopic and should be stored desiccated, often frozen, and protected from repeated freeze-thaw cycles. In laboratory handling, aliquots reduce repeated temperature changes, and chelating agents may limit metal-catalyzed hydrolysis in some buffers. These practices matter because even small amounts of NADH or hydrolysis products can interfere with quantitative assays.
Quality control for NAD+ materials typically combines identity, purity, and water content checks. Identity may be confirmed by ultraviolet spectrum, retention time in chromatography, or mass accuracy, while purity is assessed by HPLC peak area or quantitative nuclear magnetic resonance. Residual water and solvents can affect molar calculations and enzyme assays, so Karl Fischer titration or thermogravimetric analysis may be used. Commercial materials vary in grade and counterion form, and published methods should specify the exact salt or hydrate when reporting concentrations. Regulatory status depends on intended use, with research reagents, dietary ingredients, and clinical products treated under different frameworks.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized or precipitated solid |
| Solubility | Water-soluble | Also soluble in aqueous buffers; limited in nonpolar solvents |
| Typical storage | -20 °C, desiccated | Short-term solutions may be kept at 2-8 °C |
| Common analytical method | HPLC with UV detection | LC-MS provides additional confirmation |
| Stability risk | Hydrolysis | Accelerated by heat, extreme pH, and repeated freeze-thaw |
NAD+ is a dinucleotide composed of adenine, ribose, and nicotinamide groups joined by phosphate linkages. It serves as a coenzyme in oxidoreductase reactions, cycling between oxidized NAD+ and reduced NADH. The molecule is water-soluble and occurs in all living cells. Its nicotinamide ring accepts hydride ions during catabolic reactions, linking substrate oxidation to electron transport. This redox couple supports ATP production and helps maintain cytosolic and mitochondrial redox balance in many cell types.
Beyond redox catalysis, NAD+ is a substrate for enzymes that transfer ADP-ribose or remove acetyl groups from proteins. Sirtuins and poly(ADP-ribose) polymerases consume NAD+ and release nicotinamide as a byproduct. These reactions connect cellular energy status to gene regulation, DNA repair, and stress responses. Because NAD+ is used rather than merely recycled in such signaling, its concentration reflects both biosynthesis and consumption. The balance between salvage and de novo synthesis pathways determines available pools in different tissues.
Nicotinamide adenine dinucleotide, commonly abbreviated NAD+, is a dinucleotide coenzyme built from an adenine nucleotide and a nicotinamide nucleotide joined by a pyrophosphate linkage. Its oxidized form carries a positive charge on the nicotinamide ring, while the reduced form, NADH, carries a hydride equivalent. The molecule participates in hundreds of oxidoreductase reactions, where it accepts or donates electrons and protons. Because it can cycle between oxidized and reduced states without net consumption, NAD+ functions as a reusable electron carrier rather than a fuel molecule.
In glycolysis, the tricarboxylic acid cycle, and fatty acid oxidation, NAD+ is reduced to NADH at specific dehydrogenase steps. NADH then delivers electrons to the mitochondrial electron transport chain, mainly at complex I, supporting oxidative phosphorylation and ATP production. The balance between NAD+ and NADH, often expressed as a ratio, influences metabolic flux and redox homeostasis in different cellular compartments. Cytosolic and mitochondrial pools are connected but not identical, and their ratios can differ substantially because of compartment-specific enzymes and transport systems.
Marker horizons are stratigraphic units of the same age and of such distinctive composition and appearance that, despite their presence in different geographic sites, there is certainty about their age-equivalence. Fossil faunal and floral assemblages, both marine and terrestrial, make for distinctive marker horizons. Tephrochronology is a method for geochemical correlation of unknown volcanic ash (tephra) to geochemically fingerprinted, dated tephra. Tephra is also often used as a dating tool in archaeology, since the dates of some eruptions are well-established.
Several genetic and environmental risk factors exist for developing an addiction. Genetic and environmental risk factors each account for roughly half of an individual's risk for developing an addiction; the contribution from epigenetic risk factors to the total risk is unknown. Even in individuals with a relatively low genetic risk, exposure to sufficiently high doses of an addictive drug for a long period of time (e.g., weeks–months) can result in an addiction.
== History and literature == The compound was discovered by Justus von Liebig and Friedrich Wöhler. It is one of the oldest named organic compounds. It was originally prepared in 1818 by Luigi Valentino Brugnatelli (1761-1818) and was named in 1838 by Wöhler and Liebig. The name "Alloxan" emerged from an amalgamation of the words "Allantoïn" and "Oxalsäure" (oxalic acid). The alloxan model of diabetes was first described in rabbits by Dunn, Sheehan, and McLetchie in 1943. The name is derived from allantoin, a product of uric acid excreted by the fetus into the allantois, and oxaluric acid derived from oxalic acid and urea, found in urine. Alloxan was used in the production of the purple dye murexide, discovered by Carl Wilhelm Scheele in 1776. Murexide is the product of the complex in-situ multistep reaction of alloxantin and gaseous ammonia. Murexide results from the condensation of the unisolated intermediate uramil with alloxan liberated during the course of the reaction.
Sources: en.wikipedia.org
The Soviet Union imposed heavy controls on city growth, preventing some cities from reaching their full potential while promoting others. For the entirety of the Soviet Union's existence, the most populous cities were Moscow and Leningrad (both in Russian SFSR), with the third far place taken by Kiev (Ukrainian SSR). At the USSR's inception, the fourth and fifth most populous cities were Kharkov (Ukrainian SSR) and Baku (Azerbaijan SSR), but, by the end of the century, Tashkent (Uzbek SSR), which had assumed the position of capital of Soviet Central Asia, had risen to fourth place. Minsk (Byelorussian SSR) saw rapid growth during the 20th century, rising from the 32nd most populous in the union to the 7th.
Necrophagous flies and beetles play an important role in forensic entomology due to their postmortem colonization of human remains. For example, in homicide cases, forensic medical examiners can sometimes determine the minimum post-mortem interval based on the fly and beetle species present in the body and their development stage. This is because these insects rarely deposit eggs in live hosts, they colonize bodies in a predictable sequence following death, and information is available on how long it takes different species to reach different stages of development. Because insect arrival and departure time and larval development time are affected by seasonal changes, temperature, moisture levels, air exposure, geographical region, and other factors, these must all be carefully considered when estimating minimum post-mortem interval.
Rare polymorphisms related to this disease include (MTRR):c.1459G>A, (MTRR):c.1623-1624insTA and (MTRR):c.903+469T>C. These mutations, excluding (MTRR):c.1459G>A result in a frame shift, producing premature termination codons. As consequent products are distant from normal, mutant mRNA arises and nonsense mediated decay (FMN) is initiated. The large insertion of 903_904ins140 corresponding to 903+469T>C is most prevalent in CblE pathology. The activation of an enhanced splicer within intron 6 is incomplete, producing small quantities of normal spliced MTRR mRNA. Prenatal diagnosis of this condition is possible using [14C] methyltetrahydrofolate. Mutation analysis in native chorionic villi and [14C] formate in amino acids within these villi or cultured amniocytes is indicative of the CblE defect. Additionally, macrocytic anemia is a typical feature of the CblE defect and can be corrected though OH-Cobalamin administration or folate supplementation.
Sources: en.wikipedia.org
These groups lobby for the enhancement of water quality standards, particularly the inclusion of CEC in the monitoring and treatment protocols of wastewater facilities, resulting in improved effluent quality NECRI.
A genetic admixture study by Kshatriya (1995) found the Sinhalese to have a higher contribution from Indian Tamils (69.86% +/- 0.61), compared with the Bengalis (25.41% +/- 0.51). Genetic distance analysis by Roychoudhury AK et al. (1985) suggested the Sinhalese are more closely related to South and West Indian populations, than the Bengalis. Genetic distance analysis by Kirk (1976) suggested the Sinhalese are closer to the Tamils and Keralites of South India, than they are to the populations in Gujarat or the Panjab.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
Sources: en.wikipedia.org
Many enzymes consume or produce NAD+ within seconds after a sample is collected. Quenching stops those reactions and helps preserve the ratio between oxidized and reduced forms. The exact quenching method depends on the tissue or cell type and the analytes of interest.
NAD+ is present in blood cells, but plasma measurements are complicated by release from cells during processing. Careful collection and immediate separation of cellular components are required. Researchers often prefer specific cell or tissue samples to answer questions about NAD+ pools.
Solid NAD+ is dissolved in suitable aqueous buffer, often near neutral pH, and kept cold. Solutions are typically aliquoted to avoid repeated freeze-thaw cycles. Protection from light and microbial contamination supports stability during storage.
Common methods include LC-MS, HPLC with UV detection, and enzymatic cycling assays. Rapid quenching is needed because NAD+ and NADH interconvert. The chosen method should be validated for the sample matrix.